missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FPR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
359.00 € - 563.00 €
Specifications
| Antigen | FPR1 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18035676
|
Novus Biologicals
NBP2-47452 |
0.1 mL |
563.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18624326
|
Novus Biologicals
NBP2-47452-25ul |
25 μL |
359.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
FPR1 Polyclonal specifically detects FPR1 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| FPR1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse | |
| fMet-Leu-Phe receptor, FMLP, fMLP receptor, formyl peptide receptor 1, FPRfMet-Leu-Phe receptor, N-formyl peptide receptor, N-formylpeptide chemoattractant receptor | |
| FPR1 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| GPCR, Immunology, Protein Kinase | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 2357 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLT | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title