missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FPR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
359.00 € - 563.00 €
Specifications
| Antigen | FPR1 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18035676
|
Novus Biologicals
NBP2-47452 |
0.1 mL |
563.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18624326
|
Novus Biologicals
NBP2-47452-25ul |
25 μL |
359.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
FPR1 Polyclonal specifically detects FPR1 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Spezifikation
| FPR1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse | |
| fMet-Leu-Phe receptor, FMLP, fMLP receptor, formyl peptide receptor 1, FPRfMet-Leu-Phe receptor, N-formyl peptide receptor, N-formylpeptide chemoattractant receptor | |
| FPR1 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| GPCR, Immunology, Protein Kinase | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 2357 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLT | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts