missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FXYD3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-81256-25ul
This item is not returnable.
View return policy
Description
FXYD3 Polyclonal antibody specifically detects FXYD3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| FXYD3 | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Chloride conductance inducer protein Mat-8, FXYD domain containing ion transport regulator 3, FXYD domain-containing ion transport regulator 3, Mammary tumor 8 kDa protein, MAT8MAT-8, Phospholemman-like, phospholemman-like protein, PLMLMGC111076 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MSEWRSSGEQAGRGWGSPPLTTQLSPTGAKCKCKFGQKSGHHPGETPPLITPGSAQS | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 5349 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction