missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GKAP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-33989
This item is not returnable.
View return policy
Description
GKAP1 Polyclonal specifically detects GKAP1 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| GKAP1 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q5VSY0 | |
| GKAP1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ITQWEAKYKEVKARNAQLLKMLQEGEMKDKAEILLQVDESQSIKNELTIQVTSLHAALEQERSKVKVLQAELAKYQGGRKGKRNSESDQCR | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin), Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| cGMP-dependent protein kinase-anchoring protein of 42 kDa, FKSG21, FLJ25469, G kinase anchoring protein 1, G kinase-anchoring protein 1, GKAP42cGMP-dependent protein kinase anchoring protein 42kDa, protein kinase anchoring protein GKAP42 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 80318 | |
| Human, Mouse | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction