missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GLI-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 593.00 €
Spezifikation
| Antigen | GLI-1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|
18236264
|
Novus Biologicals
NBP2-56230 |
100 μL |
593.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18641727
|
Novus Biologicals
NBP2-56230-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
GLI-1 Polyclonal specifically detects GLI-1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Spezifikation
| GLI-1 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Signal Transduction, Stem Cell Signaling Pathway, Transcription Factors and Regulators | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 2735 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PPENGASSLPGLMPAQHYLLRARYASARGGGTSPTAASSLDRIGGLPMPPWRSRAEYPGYNPNAGVTRRASDPAQAADRPAPARVQRFKS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| GLI family zinc finger 1, Glioma-associated oncogene, glioma-associated oncogene family zinc finger 1, glioma-associated oncogene homolog 1 (zinc finger protein), GLIzinc finger protein GLI1, Oncogene GLI | |
| GLI1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts