missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glutathione Peroxidase 2/GPX2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 572.00 €
Specifications
| Antigen | Glutathione Peroxidase 2/GPX2 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18198207
|
Novus Biologicals
NBP2-47447 |
0.1 mL |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18630716
|
Novus Biologicals
NBP2-47447-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Glutathione Peroxidase 2/GPX2 Polyclonal specifically detects Glutathione Peroxidase 2/GPX2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Glutathione Peroxidase 2/GPX2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 2877 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| EC 1.11.1, EC 1.11.1.9, Gastrointestinal glutathione peroxidase, gastrointestinal glutathione peroxidase 2, GI-GPx, glutathione peroxidase 2, glutathione peroxidase 2 (gastrointestinal), Glutathione peroxidase-gastrointestinal, Glutathione peroxidase-related protein 2, GPRP, GPRP-2, GPx-2, GPx-GI, GSHPx-2, GSHPx-GI | |
| GPX2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title