missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GM-CSF Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
294.00 € - 510.00 €
Specifications
| Antigen | GM-CSF |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18226182
|
Novus Biologicals
NBP2-56177 |
100 μL |
510.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18625616
|
Novus Biologicals
NBP2-56177-25ul |
25 μL |
294.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GM-CSF Polyclonal specifically detects GM-CSF in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| GM-CSF | |
| Polyclonal | |
| Rabbit | |
| Cytokine Research, Immunology | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 1437 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:STQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| colony stimulating factor 2 (granulocyte-macrophage), Colony-stimulating factor, CSF, GM-CSF, GMCSFgranulocyte-macrophage colony-stimulating factor, granulocyte-macrophage colony stimulating factor, MGC131935, MGC138897, molgramostin, sargramostim | |
| CSF2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title