missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GNPTAB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
501.00 €
Specifications
| Antigen | GNPTAB |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
GNPTAB Polyclonal specifically detects GNPTAB in Human samples. It is validated for Western Blot.Specifications
| GNPTAB | |
| Polyclonal | |
| Rabbit | |
| Q3T906 | |
| 79158 | |
| Synthetic peptide directed towards the N terminal of human GNPTAB (NP_077288). Peptide sequence FQFGEVVLEWSRDQYHVLFDSYRDNIAGKSFQNRLCLPMPIDVVYTWVNG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZp762B226, GlcNAc phosphotransferase, glucosamine (UDP-N-acetyl)-lysosomal-enzyme N-acetylglucosamine phosphotransferase, GNPTA, ICD, KIAA1208, MGC4170, N-acetylglucosamine-1-phosphate transferase, alpha and beta subunits, stealth protein GNPTAB, UDP-N-acetylglucosamine-lysosomal-enzyme N-acetylglucosamine | |
| GNPTAB | |
| IgG | |
| 144 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title