missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GPRC5A/RAI3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
353.00 € - 572.00 €
Specifications
| Antigen | GPRC5A/RAI3 |
|---|---|
| Dilution | Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, Immunohistochemistry Free-Floating 1:1000 - 1:2500 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18421641
|
Novus Biologicals
NBP1-89743-25ul |
25 μL |
353.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18093714
|
Novus Biologicals
NBP1-89743 |
0.1 mL |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GPRC5A/RAI3 Polyclonal specifically detects GPRC5A/RAI3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry Free-Floating.Specifications
| GPRC5A/RAI3 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| G protein-coupled receptor, family C, group 5, member A, GPCR5A, Orphan G-protein-coupling receptor PEIG-1, RAI3G-protein coupled receptor family C group 5 member A, RAIG1RAIG-1, retinoic acid induced 3, retinoic acid responsive, Retinoic acid-induced gene 1 protein, retinoic acid-induced protein 3 | |
| GPRC5A | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, Immunohistochemistry Free-Floating 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| GPCR | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 9052 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title