missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GXYLT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 605.00 €
Specifications
| Antigen | GXYLT2 |
|---|---|
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Code produit | Marque | Quantity | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantity | Prix | Quantité et disponibilité | |||||
|
18621258
|
Novus Biologicals
NBP2-49553-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18688606
|
Novus Biologicals
NBP2-49553 |
0.1 mL |
605.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GXYLT2 Polyclonal antibody specifically detects GXYLT2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Spécification
| GXYLT2 | |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| EC 2.4.2.n2, GLT8D4, Glucoside Xylosyltransferase 2, Glycosyltransferase 8 Domain Containing 4, Glycosyltransferase 8 Domain-Containing Protein 4 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MNLTRIRSTQFKNSMIPTGLAWEDMLYPLYQKYKNAITWGDQ | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2), 40% Glycerol | |
| 727936 | |
| IgG | |
| Immunogen affinity purified |
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit