missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HABP1/C1QBP/GC1q R Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP1-89790-25ul
This item is not returnable.
View return policy
Description
HABP1/C1QBP/GC1q R Polyclonal specifically detects HABP1/C1QBP/GC1q R in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| HABP1/C1QBP/GC1q R | |
| Polyclonal | |
| Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| C1q globular domain-binding protein, C1qBP, complement component 1 Q subcomponent-binding protein, mitochondrial, complement component 1, q subcomponent binding protein, GC1QBP, gC1qR, gC1Q-R, GC1q-R protein, Glycoprotein gC1qBP, HABP1p33, Hyaluronan-binding protein 1, Mitochondrial matrix protein p32, p32, SF2P32, splicing factor SF2-associated protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of human HABP1/C1QBP/GC1q R antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| C1QBP | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:GGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHY | |
| 25 μL | |
| Stem Cell Markers | |
| 708 | |
| Human, Mouse, Rat | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction