missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HFM1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
433.00 € - 725.00 €
Specifications
| Antigen | HFM1 |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL |
| Applications | Immunocytochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18483001
|
Novus Biologicals
NBP1-81954-25ul |
25 μL |
433.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18451331
|
Novus Biologicals
NBP1-81954 |
0.1 mL |
725.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HFM1 Polyclonal antibody specifically detects HFM1 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| HFM1 | |
| Immunocytochemistry | |
| Unconjugated | |
| Rabbit | |
| Cell Biology | |
| PBS (pH 7.2) and 40% Glycerol | |
| 164045 | |
| IgG | |
| Immunogen affinity purified |
| Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| FLJ39011, helicase-like protein HFM1, HFM1, ATP-dependent DNA helicase homolog (S. cerevisiae), probable ATP-dependent DNA helicase HFM1, RP11-539G11.1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:FVGLDIQQKLTVFYLEPKRFGNQITMQRKSETQISHSKHSDISTIAGPNKGTTASKKPGNRECNHLCK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title