missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HLA DRA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
302.00 € - 498.00 €
Specifications
| Antigen | HLA DRA |
|---|---|
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18173948
|
Novus Biologicals
NBP2-38691 |
0.1 mL |
498.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18649025
|
Novus Biologicals
NBP2-38691-25ul |
25 μL |
302.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HLA DRA Polyclonal specifically detects HLA DRA in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| HLA DRA | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P01903 | |
| 3122 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: AIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Adaptive Immunity, Cell Biology, Diabetes Research, Immunology | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FLJ51114, histocompatibility antigen HLA-DR alpha, HLA class II histocompatibility antigen, DR alpha chain, HLA-DRA1, major histocompatibility complex, class II, DR alpha, MHC cell surface glycoprotein, MHC class II antigen DRA, MLRW | |
| HLA-DRA | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title