missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HS3ST5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 624.00 €
Specifications
| Antigen | HS3ST5 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18236314
|
Novus Biologicals
NBP2-55930 |
100 μL |
624.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18698128
|
Novus Biologicals
NBP2-55930-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HS3ST5 Polyclonal specifically detects HS3ST5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| HS3ST5 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 3-OST-5EC 2.8.2.23, 3OST5NBLA04021, EC 2.8.2, h3-OST-5, heparan sulfate (glucosamine) 3-O-sulfotransferase 5, heparan sulfate 3-OST-5, Heparan sulfate 3-O-sulfotransferase 5, Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 5, heparan sulfate glucosamine 3-O-sulfotransferase 5, HS3OST5 | |
| HS3ST5 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 222537 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DYTQVLEGKERKNKTYYKFEKLAIDPNTCEVNTKYKAVRTSIYTKHLERWLKYFPIEQFHVVDGDRLITEPLP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title