missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HSP60 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
302.00 € - 430.00 €
Specifications
| Antigen | HSP60 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18444201
|
Novus Biologicals
NBP1-89730-25ul |
25 μL |
302.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18278796
|
Novus Biologicals
NBP1-89730 |
0.1 mL |
430.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HSP60 Polyclonal specifically detects HSP60 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| HSP60 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| 60 kDa chaperonin, Chaperonin 60, CPN60, GROEL, heat shock 60kD protein 1 (chaperonin), heat shock 60kDa protein 1 (chaperonin), Heat shock protein 60, heat shock protein 65, HLD4, Hsp60, HSP-60, HSP60SPG13, HSP65, HuCHA60, Mitochondrial matrix protein P1,60 kDa heat shock protein, mitochondrial, P60 lymphocyte protein, short heat shock protein 60 Hsp60s1, spastic paraplegia 13 (autosomal dominant) | |
| HSPD1 | |
| IgG | |
| Affinity Purified | |
| Specificity of human HSP60 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cellular Markers, Membrane Trafficking and Chaperones, Mitochondrial Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 3329 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:RVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAEL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title