missing translation for 'onlineSavingsMsg'
Learn More

HUNK Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP2-14111

View more versions of this product

Product Code. 18190990

572.00 € / 0.10mL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

HUNK Polyclonal specifically detects HUNK in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	HUNK
Classification	Polyclonal
Dilution	Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias	B19, EC 2.7.11, EC 2.7.11.1, hormonally up-regulated neu tumor-associated kinase, hormonally upregulated neu tumor-associated kinase, hormonally up-regulated Neu-associated kinase, hormonally upregulated Neu-associated kinase, MAKV, serine/threonine protein kinase MAK-V, Serine/threonine-protein kinase MAK-V
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols	HUNK
Immunogen	This antibody was developed against a recombinant protein corresponding to the amino acids: NSPVSLACRNSSERTLSPGLPSGSMSPLHTPLHPTLVSFAHEDKNSPPKEEGLCCPPPVPSNGPMQPLGSPNCVKSRGRFPMMGIG
Quantity	0.1 mL
Research Discipline	Cancer, GPCR, Protein Kinase
Gene ID (Entrez)	30811
Target Species	Human
Isotype	IgG

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

HUNK Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions