missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IER5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
375.00 € - 515.00 €
Specifications
| Antigen | IER5 |
|---|---|
| Dilution | Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18409060
|
Novus Biologicals
NBP1-85935-25ul |
25 μL |
375.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18274798
|
Novus Biologicals
NBP1-85935 |
0.1 mL |
515.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
IER5 Polyclonal specifically detects IER5 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| IER5 | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 51278 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:RRNLEQPPSGGEDDDAEEMETGNVANLISIFGSSFSGLLRKSPGGGREEEEGEESGPEAAEPGQICCDKPV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse | |
| immediate early response 5, immediate early response gene 5 protein, MGC102760, SBBI48 | |
| IER5 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title