missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IFT122 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
415.00 € - 624.00 €
Specifications
| Antigen | IFT122 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18461901
|
Novus Biologicals
NBP1-87014-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18295496
|
Novus Biologicals
NBP1-87014 |
0.1 mL |
624.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
IFT122 Polyclonal specifically detects IFT122 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| IFT122 | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 55764 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:ITKQADWARNIKEPKAAVEMYISAGEHVKAIEICGDHGWVDMLIDIARKLDKAEREPLLLCATYLKKLDSPGYAAETYLKMGDLK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Polyclonal | |
| Rabbit | |
| Human | |
| intraflagellar transport 122 homolog (Chlamydomonas), intraflagellar transport protein 122 homolog, SPGWD repeat-containing protein 140, WD repeat domain 10, WD repeat-containing protein 10, WDR10WDR10p, WDR140CED | |
| IFT122 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title