missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IL-10R alpha Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
401.00 € - 672.00 €
Specifications
| Antigen | IL-10R alpha |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18654474
|
Novus Biologicals
NBP3-21324-100ul |
100 μg |
672.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18604135
|
Novus Biologicals
NBP3-21324-25ul |
25 μg |
401.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
IL-10R alpha Polyclonal antibody specifically detects IL-10R alpha in Human samples. It is validated for ImmunofluorescenceSpecifications
| IL-10R alpha | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cytokine Research | |
| PBS, pH 7.2, 40% glycerol | |
| 3587 | |
| IgG | |
| Affinity purified |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CD210 antigen, CDw210a, HIL-10R, IBD28, IL-10 receptor subunit alpha, IL-10R subunit 1, IL-10R1, IL-10RA, IL10RIL-10R subunit alpha, interleukin 10 receptor, alpha, interleukin-10 receptor alpha chain, Interleukin-10 receptor subunit 1, interleukin-10 receptor subunit alpha | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: HGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWNSISNCSQTLSYDL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title