missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ IL22RA2 Polyclonal Antibody
Goat Polyclonal Antibody
Brand: Invitrogen™ PA121359
This item is not returnable.
View return policy
Description
Recommended positive controls: Human spleen or tonsil..
IL22, a homolog of IL10, is secreted by T cells and binds to and signals through the class II cytokine receptor family (CRF) heterodimer IL22RA /IL10RB. IL22 induces the production of acute-phase reactants.
Specifications
| IL22RA2 | |
| Polyclonal | |
| Unconjugated | |
| IL22RA2 | |
| CRF2-10; CRF2-S1; CRF2X; Cytokine receptor class-II member 10; Cytokine receptor family 2 member 10; cytokine receptor family II soluble 1; cytokine receptor family type 2, soluble 1; IL-22 receptor subunit alpha-2; IL22BP; IL-22BP; Il22ra2; IL-22RA2; IL-22R-alpha-2; interleukin 22 receptor subunit alpha 2; interleukin 22 receptor, alpha 2; interleukin 22-binding protein; interleukin-22 receptor subunit alpha-2; Interleukin-22-binding protein; UNQ5793/PRO19598/PRO19822; ZcytoR16 | |
| Goat | |
| Affinity chromatography | |
| RUO | |
| 116379, 237310, 444986 | |
| Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. | |
| Liquid |
| ELISA, Immunohistochemistry (Paraffin) | |
| 1 mg/mL | |
| PBS with 0.1% BSA and 0.1% sodium azide | |
| Q7TNI4, Q80XF5, Q969J5 | |
| IL22RA2 | |
| Synthetic peptide RVQFQSRNFHNILQWQPGRALTGNSSVY-C corresponding to 33-60 residues of N-terminus of human IL-22R-alpha-2 protein with cysteine added for conjugation to a carrier protein. | |
| 100 μg | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction