missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IMP2/IGF2BP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-33992-25ul
This item is not returnable.
View return policy
Description
IMP2/IGF2BP2 Polyclonal specifically detects IMP2/IGF2BP2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| IMP2/IGF2BP2 | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Q9Y6M1 | |
| IGF2BP2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ITVKGTVEACASAEIEIMKKLREAFENDMLAVNTHSGYFSSLYPHHQFGPFPHHHSYPEQEIVNLFIPTQAV | |
| 25 μL | |
| Cancer, Chromatin Research, Immune System Diseases, Immunology, Transcription Factors and Regulators | |
| 10644 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Hepatocellular carcinoma autoantigen p62, IGF-II mRNA-binding protein 2, IMP-2IGF2 mRNA-binding protein 2, IMP2VICKZ family member 2, insulin-like growth factor 2 mRNA binding protein 2, insulin-like growth factor 2 mRNA-binding protein 2, p62, VICKZ2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction