missing translation for 'onlineSavingsMsg'
Learn More

IZUMO1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP1-69692

Product Code. 18285225

483.00 € / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

IZUMO1 Polyclonal specifically detects IZUMO1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	IZUMO1
Classification	Polyclonal
Conjugate	Unconjugated
Formulation	PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias	FLJ61440, IZUMO, izumo sperm-egg fusion 1, izumo sperm-egg fusion protein 1, MGC34799, OBF, Oocyte binding/fusion factor, Sperm-specific protein izumo
Host Species	Rabbit
Molecular Weight of Antigen	39 kDa
Quantity	100 μL
Primary or Secondary	Primary
Reconstitution	Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Applications	Western Blot
Concentration	0.5 mg/ml
Dilution	Western Blot 1.0 ug/ml
Gene Accession No.	Q8IYV9
Gene Symbols	IZUMO1
Immunogen	Synthetic peptides corresponding to IZUMO1(izumo sperm-egg fusion 1) The peptide sequence was selected from the C terminal of IZUMO1. Peptide sequence SLALITGLTFAIFRRRKVIDFIKSSLFGLGSGAAEQTQVPKEKATDSRQQ.
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	284359
Target Species	Human
Isotype	IgG

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

IZUMO1 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions