missing translation for 'onlineSavingsMsg'
Learn More

Jagged 1 Antibody (1E12), Novus Biologicals™

Mouse Monoclonal Antibody

Brand: Novus Biologicals H00000182-M01A

Product Code. 18654739

591.00 € / 0.20mL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Jagged 1 Monoclonal antibody specifically detects Jagged 1 in Human, Mouse samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Gene Knock-Out

Specifications

Antigen	Jagged 1
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	Ascites
Gene Alias	AGS, AHDMGC104644, Alagille syndrome, AWS, CD339, CD339 antigen, HJ1, jagged 1, Jagged1, JAGL1, protein jagged-1
Immunogen	JAG1 (NP_000205, 531 a.a. ∽ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PNPCQNGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKG
Quantity	0.2 mL
Research Discipline	Angiogenesis, Cancer, Growth and Development, Neuronal Cell Markers, Stem Cell Signaling Pathway
Gene ID (Entrez)	182
Content And Storage	Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Isotype	IgG1 κ

Applications	Western Blot, ELISA, Immunohistochemistry, Gene Knock-Out
Clone	1E12
Dilution	Western Blot 1:500, ELISA, Immunohistochemistry, Knockout Validated
Gene Accession No.	NP_000205
Host Species	Mouse
Purification Method	Unpurified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human, Mouse
Form	Purified

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

Jagged 1 Antibody (1E12), Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions