missing translation for 'onlineSavingsMsg'
Learn More
Learn More
JMJD1C Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 624.00 €
Specifications
| Antigen | JMJD1C |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18292765
|
Novus Biologicals
NBP2-55700 |
100 μL |
624.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18691568
|
Novus Biologicals
NBP2-55700-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
JMJD1C Polyclonal specifically detects JMJD1C in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| JMJD1C | |
| Polyclonal | |
| Rabbit | |
| Human | |
| DKFZp761F0118, EC 1.14.11, EC 1.14.11.-, FLJ14374, JHDM2C, jumonji domain containing 1C, Jumonji domain-containing protein 1C, KIAA1380TR-interacting protein 8, probable JmjC domain-containing histone demethylation protein 2C, RP11-10C13.2, thyroid hormone receptor interactor 8, thyroid receptor interacting protein 8, Thyroid receptor-interacting protein 8, TRIP8, TRIP-8 | |
| JMJD1C | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 221037 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IIPGSVLTDLLDAMHTLREKYGIKSHCHCTNKQNLQVGNFPTMNGVSQVLQNVLNHSNKISLCMPESQQQNTPPKS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title