missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 15964115

KCNH2 Polyclonal Antibody, Invitrogen™

Product Code. 15964115
Change view
Click to view available options
Quantity:
50 μL
Unit Size:
50µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
15964115 50 μL 50µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 15964115 Supplier Invitrogen Supplier No. PA577612

Please to purchase this item. Need a web account? Register with us today!

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 View alternative products

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Product is shipped at room temperature as a lyophilized powder and should be stored at -20 °C upon receipt. Reconstitution: add 50 μL of deionized water.

Human ether-a-go-go related gene (HERG) encodes the pore-forming alpha subunit of the delayed rectifier potassium channel IKr. There are two N-terminal splice variants of HERG include the full-length isoform 1 alpha and the shorter isoform 1 beta. Isoform 1 beta lacks the PAS motif and deactivates at a faster rate than isoform 1alpha. Residues within the C-terminal play a role in channel expression and channel gating, including voltage-dependent activation. HERG is expressed in the heart and is more abundantly expressed in the ventricles than in the atria. Mutations in the gene encoding HERG increase beat-to-beat variability and early after depolarization. These fluctuations facilitate the genesis and propagation of premature heartbeats associated with inheritable long QT syndrome type 2 and short QT syndrome type 1.
TRUSTED_SUSTAINABILITY

Specifications

Antigen KCNH2
Applications Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Frozen), Immunoprecipitation, Western Blot
Classification Polyclonal
Concentration 0.6 mg/mL
Conjugate Unconjugated
Formulation PBS with 1% BSA and 0.05% sodium azide; pH 7.4
Gene KCNH2
Gene Accession No. O08962, O35219, Q12809
Gene Alias Kcnh2
Gene Symbols Kcnh2
Host Species Rabbit
Immunogen GST fusion protein with sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human Kv 11.1 (HERG)
Purification Method Antigen affinity chromatography
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 117018, 16511, 3757
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.