missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KCNMB3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
292.00 € - 572.00 €
Specifications
| Antigen | KCNMB3 |
|---|---|
| Dilution | Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18427970
|
Novus Biologicals
NBP1-83065-25ul |
25 μL |
292.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18296597
|
Novus Biologicals
NBP1-83065 |
0.1 mL |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
KCNMB3 Polyclonal specifically detects KCNMB3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| KCNMB3 | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| BK channel subunit beta-3, BKbeta3, HBETA3, KCNMB2, KCNMBL, potassium large conductance calcium-activated channel, subfamily M beta member3, slo-beta-3, subfamily M subunit beta-3, voltage and Ca2+ activated potassium channel Maxi K beta 3subunit | |
| KCNMB3 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Neuroscience | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 27094 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:RLTQHLSLLCEKYSTVVRDEVGGKVPYIEQHQFKLCIMRRSKGRAEKS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title