missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Kir2.1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 529.00 €
Specifikationer
| Antigen | Kir2.1 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Produktkod | Brand | Quantity | Pris | Kvantitet och tillgänglighet | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkod | Brand | Quantity | Pris | Kvantitet och tillgänglighet | |||||
|
18461882
|
Novus Biologicals
NBP1-87709-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18239667
|
Novus Biologicals
NBP1-87709 |
0.1 mL |
529.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivning
Kir2.1 Polyclonal specifically detects Kir2.1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifikationer
| Kir2.1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 3759 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:YEVPNTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEDDSENGVPES | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Cardiac inward rectifier potassium channel, HHBIRK1, HHIRK1, hIRK1, Inward rectifier K(+) channel Kir2.1, inward rectifier K+ channel KIR2.1, inward rectifier potassium channel 2, IRK-1, IRK1LQT7, Kir2.1, Potassium channel, inwardly rectifying subfamily J member 2, potassium inwardly-rectifying channel, subfamily J, member 2, SQT3 | |
| KCNJ2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel