missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Laminin alpha 3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
288.00 € - 572.00 €
Specifications
| Antigen | Laminin alpha 3 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18498641
|
Novus Biologicals
NBP1-89955-25ul |
25 μL |
288.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18280147
|
Novus Biologicals
NBP1-89955 |
0.1 mL |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Laminin alpha 3 Polyclonal specifically detects Laminin alpha 3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Laminin alpha 3 | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| BM600, BM600 150kD subunit, BM600-150kDa, E170, epiligrin, Epiligrin 170 kDa subunit, epiligrin alpha 3 subunit, Epiligrin subunit alpha, kalinin 165kD subunit, Kalinin subunit alpha, kalinin-165kDa, lama3a, laminin subunit alpha-3, laminin, alpha 3, laminin, alpha 3 (nicein (150kD), kalinin (165kD), BM600 (150kD), epilegrin), laminin-5 alpha 3 chain, Laminin-5 subunit alpha, Laminin-6 subunit alpha, Laminin-7 subunit alpha, LAMNA, LOCS, nicein 150kD subunit, Nicein subunit alpha, nicein-150kDa | |
| LAMA3 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 3909 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSLLQTNIALQLMEKSQKEYE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit