missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Lano Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-88015-25ul
This item is not returnable.
View return policy
Description
Lano Polyclonal antibody specifically detects Lano in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| Lano | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
| dJ523E19.1, FLJ10775, FLJ11834, LANOLANO adapter protein, LAP (leucine-rich repeats and PDZ) and no PDZ protein, LAP and no PDZ protein, leucine rich repeat containing 1, leucine-rich repeat-containing 1, leucine-rich repeat-containing protein 1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: QSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESVGALLHLKDLWLDGNQLSELPQEIGNLKNLLCL | |
| 25 μL | |
| Cytokines and Growth Factors, Immunology, Neuroscience | |
| 55227 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunocytochemistry | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction