missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LMBR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
292.00 € - 572.00 €
Specifications
| Antigen | LMBR1 |
|---|---|
| Dilution | Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18473911
|
Novus Biologicals
NBP1-89276-25ul |
25 μL |
292.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18255458
|
Novus Biologicals
NBP1-89276 |
0.1 mL |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
LMBR1 Polyclonal specifically detects LMBR1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Spezifikation
| LMBR1 | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 64327 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:FTVMGQLLVKPTILEDLDEQIYIITLEEEALQRRLNGLSSSVEYNIMELEQELENVKTLKTKLERRKKASAWERN | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| ACHPchromosome 7 open reading frame 2, C7orf2FLJ11665, DIF14, Differentiation-related gene 14 protein, limb region 1 homolog (mouse), limb region 1 protein homolog, PPD2, TPT | |
| LMBR1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts