missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MAGED2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP1-89413
This item is not returnable.
View return policy
Description
MAGED2 Polyclonal specifically detects MAGED2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| MAGED2 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| 11B6MAGE-D2 antigen, BCG-1, BCG1MAGEDHCA10, breast cancer associated gene 1, Breast cancer-associated gene 1 protein, hepatocellular carcinoma associated protein, hepatocellular carcinoma-associated protein HCA10, Hepatocellular carcinoma-associated protein JCL-1, JCL-1, MAGE-D2, melanoma antigen family D, 2, melanoma-associated antigen D2, MGC8386 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| MAGED2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LTDTQVLAAENKSLAADTKKQNADPQAVTMPATETKKVSHVADTKVNTKAQETEAAPSQAPADEPEPESAAAQSQENQDTR | |
| 0.1 mL | |
| Cancer, Immunology | |
| 10916 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction