missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MAP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
450.00 € - 708.00 €
Specifications
| Antigen | MAP1 |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18673994
|
Novus Biologicals
NBP3-21408-25ul |
25 μg |
450.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18654244
|
Novus Biologicals
NBP3-21408-100ul |
100 μg |
708.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MAP1 Polyclonal antibody specifically detects MAP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| MAP1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, MAP Kinase Signaling | |
| PBS, pH 7.2, 40% glycerol | |
| 64112 | |
| IgG | |
| Affinity purified |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| MAP1, MAP-1PNMA4Paraneoplastic antigen Ma4, modulator of apoptosis 1, paraneoplastic antigen like 4 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: GEGMTVGELSRALGHENGSLDPEQGMIPEMWAPMLAQALEALQPALQCLKYKKLRVFSGRESPEPGEEEFGRWMF | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title