missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MARCKS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-62663
This item is not returnable.
View return policy
Description
MARCKS Polyclonal antibody specifically detects MARCKS in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| MARCKS | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| 80K-L, 80K-L protein, FLJ14368, MACSmyristoylated alanine-rich C-kinase substrate, MRACKS, myristoylated alanine-rich protein kinase C substrate, myristoylated alanine-rich protein kinase C substrate (MARCKS, 80K-L), phosphomyristin, PKCSLFLJ90045, PRKCSL, Protein kinase C substrate, 80 kDa protein, light chain | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQ | |
| 100 μg | |
| Lipid and Metabolism, Signal Transduction | |
| 4082 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction