missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MARK4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
433.00 € - 572.00 €
Specifications
| Antigen | MARK4 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18400141
|
Novus Biologicals
NBP1-83442-25ul |
25 μL |
433.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18283228
|
Novus Biologicals
NBP1-83442 |
0.1 mL |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MARK4 Polyclonal specifically detects MARK4 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| MARK4 | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| EC 2.7.11, EC 2.7.11.1, FLJ12177, FLJ90097, KIAA1860MARK4L, MAP/microtubule affinity-regulating kinase 4, MAP/microtubule affinity-regulating kinase like 1, MAP/microtubule affinity-regulating kinase-like 1, MARK4 serine/threonine protein kinase, MARKL1L, MARKL1MARK4S, Nbla00650 | |
| MARK4 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 57787 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PSDTTNGTSSSKGTSHSKGQRSSSSTYHRQRRHSDFCGPSPAPLHPKRSPTSTGEAELKEERLPGRKASCSTAGSGSR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title