missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MATE1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
369.00 € - 554.00 €
Specifications
| Antigen | MATE1 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18400522
|
Novus Biologicals
NBP1-87909-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18011694
|
Novus Biologicals
NBP1-87909 |
0.1 mL |
554.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MATE1 Polyclonal specifically detects MATE1 in Human, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| MATE1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 55244 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:HANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRKQ | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| hMATE-1, MATE-1, MATE1FLJ10847multidrug and toxin extrusion 1, MGC64822, multidrug and toxin extrusion protein 1, Solute carrier family 47 member 1, solute carrier family 47, member 1 | |
| SLC47A1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title