missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MED19 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
386.00 € - 593.00 €
Specifications
| Antigen | MED19 |
|---|---|
| Applications | Immunofluorescence, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|
18497620
|
Novus Biologicals
NBP1-81320-25ul |
25ul |
386.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18717543
|
Novus Biologicals
NBP1-81320 |
0.1 mL |
593.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
MED19 Polyclonal specifically detects MED19 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Spezifikation
| MED19 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| LCMR1mediator of RNA polymerase II transcription subunit 19, Lung cancer metastasis-related protein 1, mediator complex subunit 19DT2P1G7, mediator of RNA polymerase II transcription, subunit 19 homolog, mediator of RNA polymerase II transcription, subunit 19 homolog (S. cerevisiae) | |
| MED19 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunofluorescence, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 219541 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:GSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts