missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MEK1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
302.00 € - 456.00 €
Specifications
| Antigen | MEK1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18473632
|
Novus Biologicals
NBP1-87790-25ul |
25 μL |
302.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18285168
|
Novus Biologicals
NBP1-87790 |
0.1 mL |
456.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MEK1 Polyclonal antibody specifically detects MEK1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).Specifications
| MEK1 | |
| Polyclonal | |
| Rabbit | |
| Angiogenesis, Autophagy, Cancer, MAP Kinase Signaling, Protein Phosphatase, Signal Transduction, Tyrosine Kinases | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 5604 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQ | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Rat | |
| dual specificity mitogen-activated protein kinase kinase 1, ERK activator kinase 1, MAP kinase kinase 1, MAPK/ERK kinase 1, MAPKK1, MEK1MAPKK 1, mitogen-activated protein kinase kinase 1, MKK1MEK 1, PRKMK1EC 2.7.12.2, protein kinase, mitogen-activated, kinase 1 (MAP kinase kinase 1) | |
| MAP2K1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title