missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 18144219

Novus Biologicals™ Methionine Aminopeptidase 1/METAP1 Recombinant Protein Antigen

Product Code. 18144219 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18144219 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18144219 Supplier Novus Biologicals™ Supplier No. NBP238375PEP

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human METAP1. The Methionine Aminopeptidase 1/METAP1 Recombinant Protein Antigen is derived from E. coli. The Methionine Aminopeptidase 1/METAP1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP2-38375. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Spécification

Gene ID (Entrez) 23173
Species Human
Purification Method Chromatography
Purity >80%
Concentration 0.5mg/mL
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Symbol METAP1
Label Type Unlabeled
Molecular Weight (g/mol) 26kDa
Product Type Methionine Aminopeptidase 1/METAP1
Quantity 0.1 mL
Regulatory Status RUO
Research Category metabolism, Proteases & Other Enzymes
Source E.Coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38375. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen SVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEH
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.