missing translation for 'onlineSavingsMsg'
Learn More

MFF Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP1-70638

Product Code. 18262684

483.00 € / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

MFF Polyclonal specifically detects MFF in Human samples. It is validated for Western Blot.

Specifications

Antigen	MFF
Classification	Polyclonal
Conjugate	Unconjugated
Formulation	PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias	mitochondrial fission factor
Host Species	Rabbit
Molecular Weight of Antigen	38 kDa
Quantity	100 μL
Primary or Secondary	Primary
Test Specificity	Expected identity based on immunogen sequence: Bovine: 100%; Zebrafish: 100%; Sumatran orangutan: 100%; Canine: 100%; Chicken: 100%; Mouse: 100%; Rat: 100%; Rabbit: 100%; Human: 100%; Green puffer: 92%; Xenopus: 84%; Fusobacterium ulcerans ATCC 49185: 83%;.
Target Species	Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
Isotype	IgG

Applications	Western Blot
Concentration	0.5 mg/ml
Dilution	Western Blot 1.0 ug/ml
Gene Accession No.	Q9GZY8
Gene Symbols	MFF
Immunogen	Synthetic peptides corresponding to C2ORF33 The peptide sequence was selected from the C terminal of C2ORF33 (NP_064579). Peptide sequence VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW.
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	56947
Reconstitution	Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

MFF Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions