missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MGAM2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 589.00 €
Specifications
| Antigen | MGAM2 |
|---|---|
| Dilution | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18154309
|
Novus Biologicals
NBP2-47375 |
0.1 mL |
589.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18653396
|
Novus Biologicals
NBP2-47375-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MGAM2 Polyclonal specifically detects MGAM2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| MGAM2 | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 93432 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PQSERIDCTPDQEVTEDICRWQYKCCWSPVADANVPRCFFPWNWGYEASNGHTNTSTGFTAQLKRLPSPSLFGND | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| EC=3.2.1.3, Glucan 1,4-alpha-glucosidase, Glucoamylase, Maltase-glucoamylase (alpha-glucosidase) pseudogene, MGAM2, Probable maltase-glucoamylase 2 | |
| RP11-1220K2.2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title