missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MKK7/MEK7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 593.00 €
Specifications
| Antigen | MKK7/MEK7 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18264254
|
Novus Biologicals
NBP2-56278 |
100 μL |
593.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18649007
|
Novus Biologicals
NBP2-56278-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MKK7/MEK7 Polyclonal specifically detects MKK7/MEK7 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| MKK7/MEK7 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 5609 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| c-Jun N-terminal kinase kinase 2, dual specificity mitogen-activated protein kinase kinase 7, EC 2.7.12.2, JNK kinase 2, JNK-activating kinase 2, JNKK 2, JNKK2, MAP kinase kinase 7, MAPK/ERK kinase 7, MAPKK7, MEK 7, MEK7, mitogen-activated protein kinase kinase 7, MKK7MAPKK 7, PRKMK7 | |
| MAP2K7 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title