missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MOB4A/MOBKL1B Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-95097-0.1ml
This item is not returnable.
View return policy
Description
MOB4A/MOBKL1B Polyclonal antibody specifically detects MOB4A/MOBKL1B in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| MOB4A/MOBKL1B | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| ATS2;MATS2;MOB kinase activator 1B;MOB1B;MOB4A;MOBKL1A | |
| A synthetic peptide corresponding to a sequence within amino acids 150-250 of human MOB4A/MOBKL1B (NP_060691.2/NP_775739.1). TILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR/MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAE | |
| 0.1 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 92597 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction