missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MOGAT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 624.00 €
Specifications
| Antigen | MOGAT1 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18492142
|
Novus Biologicals
NBP2-14245-25ul |
25ul |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18068689
|
Novus Biologicals
NBP2-14245 |
0.1 mL |
624.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MOGAT1 Polyclonal specifically detects MOGAT1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| MOGAT1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 116255 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Acyl-CoA:monoacylglycerol acyltransferase 1, DC2, DGAT2L, Diacylglycerol acyltransferase 2-like protein 1, diacylglycerol O-acyltransferase 2 like 1,2-acylglycerol O-acyltransferase 1, Diacylglycerol O-acyltransferase candidate 2, EC 2.3.1, EC 2.3.1.22, MGAT1hDC2, monoacylglycerol O-acyltransferase 1DGAT2L1 | |
| MOGAT1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title