missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MSH2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
302.00 € - 498.00 €
Specifications
| Antigen | MSH2 |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18607298
|
Novus Biologicals
NBP2-68845-25ul |
25 μL |
302.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18610379
|
Novus Biologicals
NBP2-68845 |
100 μg |
498.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MSH2 Polyclonal antibody specifically detects MSH2 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| MSH2 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Breast Cancer, Cancer, Core ESC Like Genes, DNA Repair, Mismatch Repair, Stem Cell Markers, Tumor Suppressors | |
| PBS (pH 7.2) and 40% Glycerol | |
| 4436 | |
| IgG | |
| Protein A purified |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| COCA1, DNA mismatch repair protein Msh2, FCC1, hMSH2, HNPCC, HNPCC1mutS (E. coli) homolog 2 (colon cancer, nonpolyposis type 1), LCFS2, mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli), MutS protein homolog 2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: FDRGDFYTAHGEDALLAAREVFKTQGVIKYMGPAGAKNLQSVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKASKENDWYLA | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title