missing translation for 'onlineSavingsMsg'
Learn More

MTF2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP2-55885

View more versions of this product

Product Code. 18249713

624.00 € / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Beschreibung

MTF2 Polyclonal specifically detects MTF2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Spezifikation

Antigen	MTF2
Classification	Polyclonal
Dilution	Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias	metal response element binding transcription factor 2, PCL2
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Applications	Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols	MTF2
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEI
Quantity	100 μL
Research Discipline	Core ESC Like Genes, Stem Cell Markers
Gene ID (Entrez)	22823
Target Species	Human
Isotype	IgG

Produktvorschläge

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Ihr Name

E-Mail Adresse *

Art der Problems *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

For Research Use Only

Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur

MTF2 Antibody, Novus Biologicals™

Beschreibung

Spezifikation

Produktvorschläge

Dokumentation

Aktionen