missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 3 publications
353.00 € - 572.00 €
Specifications
| Antigen | Muscarinic Acetylcholine Receptor M1/CHRM1 |
|---|---|
| Dilution | Western Blot Reported in scientific literature (PMID: 24658304)., Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence Validated from a verified customer review., Immunohistochemistry-Paraffin 1:1000 - 1:2500, Immunohistochemistry-Frozen Reported in scientific literature (PMID: 24658304)., Immunohistochemistry Free-Floating Reported in scientific literature (PMID: 31785263). |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen), Immunohistochemistry (Free Floating) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18451292
|
Novus Biologicals
NBP1-87466-25ul |
25 μL |
353.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18749953
|
Novus Biologicals
NBP1-87466 |
0.1 mL |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Muscarinic Acetylcholine Receptor M1/CHRM1 Polyclonal specifically detects Muscarinic Acetylcholine Receptor M1/CHRM1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Immunohistochemistry Free-Floating.Specifications
| Muscarinic Acetylcholine Receptor M1/CHRM1 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen), Immunohistochemistry (Free Floating) | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| cholinergic receptor, muscarinic 1, HM1, M1, M1R, MGC30125, muscarinic acetylcholine receptor M1 | |
| CHRM1 | |
| IgG | |
| Affinity Purified | |
| Specificity of human Muscarinic Acetylcholine Receptor M1/CHRM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot Reported in scientific literature (PMID: 24658304)., Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence Validated from a verified customer review., Immunohistochemistry-Paraffin 1:1000 - 1:2500, Immunohistochemistry-Frozen Reported in scientific literature (PMID: 24658304)., Immunohistochemistry Free-Floating Reported in scientific literature (PMID: 31785263). | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, GPCR, Neuronal Cell Markers, Neuroscience, Neurotransmission, Transcription Factors and Regulators | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 1128 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title