missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Myosin heavy chain 13 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-05614-100ul
This item is not returnable.
View return policy
Description
Myosin heavy chain 13 Polyclonal antibody specifically detects Myosin heavy chain 13 in Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence
Specifications
| Myosin heavy chain 13 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:100, Immunocytochemistry/ Immunofluorescence 1:50 - 1:100 | |
| MYH13, MYH13 myosin, heavy chain 13, skeletal muscle, MyHC-eo | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1240-1320 of human Myosin heavy chain 13 (NP_003793.2). EALSKSKSNIERTCRTVEDQFSEIKAKDEQQTQLIHDLNMQKARLQTQNGELSHRVEEKESLISQLTKSKQALTQQLEELK | |
| 100 μg | |
| Primary | |
| Mouse, Rat | |
| Purified |
| Western Blot, Immunohistochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 8735 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction