missing translation for 'onlineSavingsMsg'
Learn More
Learn More
myosin X Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94658-0.02ml
This item is not returnable.
View return policy
Description
myosin X Polyclonal antibody specifically detects myosin X in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| myosin X | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000 | |
| FLJ10639, FLJ21066, FLJ22268, KIAA0799FLJ43256, MGC131988, myosin X, myosin-X, Unconventional myosin-10 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 845-944 of human MYO10 (NP_036466.2). EAELRAQQEEETRKQQELEALQKSQKEAELTRELEKQKENKQVEEILRLEKEIEDLQRMKEQQELSLTEASLQKLQERRDQELRRLEEEACRAAQEFLES | |
| 0.02 mL | |
| Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| 4651 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction