missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NAA25 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 572.00 €
Specifications
| Antigen | NAA25 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18454061
|
Novus Biologicals
NBP1-88391-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18246578
|
Novus Biologicals
NBP1-88391 |
0.1 mL |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NAA25 Polyclonal specifically detects NAA25 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| NAA25 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 80018 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:TGKRFIEKDIQYPFLGPVPTRMGGFFNSGCSQCQISSFYLVNDIYELDTSGLEDTMEIQERIENSFKSLLDQLKDVFSKCKGDLL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C12orf30DKFZp667K2112, chromosome 12 open reading frame 30, FLJ13089, MDM20mitochondrial distribution and morphology 20, Mitochondrial distribution and morphology protein 20, N(alpha)-acetyltransferase 25, NatB auxiliary subunit, N-alpha-acetyltransferase 25, NatB auxiliary subunit, NAP1, NatB complex subunit MDM20, N-terminal acetyltransferase B complex subunit MDM20, N-terminal acetyltransferase B complex subunit NAA25, p120 | |
| NAA25 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title