missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NAG Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00 € - 470.00 €
Specifications
| Antigen | NAG |
|---|---|
| Dilution | Western Blot 1:200-1:2000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18698521
|
Novus Biologicals
NBP2-93277-0.02ml |
0.02 mL |
190.00 €
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18693871
|
Novus Biologicals
NBP2-93277-0.1ml |
0.1 mL |
470.00 €
0.01mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NAG Polyclonal antibody specifically detects NAG in Human, Rat samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| NAG | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cell Biology | |
| PBS (pH 7.3), 50% glycerol | |
| 51594 | |
| IgG | |
| Affinity purified |
| Western Blot 1:200-1:2000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Rat | |
| DKFZp586G1219, EC 1.1.1.94, EC 1.2.1.59, FLJ40407, NAG/BC035112 fusion, NAG/FAM49A fusion, NAGneuroblastoma-amplified protein, neuroblastoma amplified sequence, Neuroblastoma-amplified gene protein, neuroblastoma-amplified sequence | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human NBAS (NP_056993.2). MAAPESGPALSPGTAEGEEETILYDLLVNTEWPPETEVQPRGNQKHGASFIITKAIRDRLLFLRQYIWYS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title