missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NAPE-PLD Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
320.00 € - 572.00 €
Specifications
| Antigen | NAPE-PLD |
|---|---|
| Dilution | Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18401731
|
Novus Biologicals
NBP1-88248-25ul |
25 μL |
320.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18245946
|
Novus Biologicals
NBP1-88248 |
0.1 mL |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NAPE-PLD Polyclonal specifically detects NAPE-PLD in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| NAPE-PLD | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| C7orf18, DKFZp781D1098, EC 3.1.4, EC 3.1.4.-, N-acyl phosphatidylethanolamine phospholipase DNAPE-PLDFMP30, N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D, NAPE-hydrolyzing phospholipase D | |
| NAPEPLD | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 222236 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALANEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNDDE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title